PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G0082
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family YABBY
Protein Properties Length: 186aa    MW: 21075.1 Da    PI: 8.5909
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G0082genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY203.86.7e-6361594170
        YABBY   4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvssekl 101
                  + ++eq+Cy+ CnfCn +lavsvP +slf +vtvrCGhCt+l svn+a a q l+ ++              +  +++++ + +ke+ +s++ +++ +
  Gh_A05G0082   6 DVAPEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQD-------------IQAPNHAMQDYRMKESGSSSKCNKFPM 90 
                  5689******************************************999998888776.............455566666777777777777777777 PP

        YABBY 102 senedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                      ++ v++   v+rPP krqrvPsayn+fikeeiqrika+nPdishreafs+aaknWahfP+ihfgl
  Gh_A05G0082  91 RPPANNVVTEERVVNRPPGKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL 159
                  77888888888889*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046904.7E-708159IPR006780YABBY protein
SuperFamilySSF470953.01E-8103152IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.7E-4107153IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MSNCIDVAPE QLCYIPCNFC NIVLAVSVPC SSLFDIVTVR CGHCTNLWSV NMAAAFQSLS  60
WQDIQAPNHA MQDYRMKESG SSSKCNKFPM RPPANNVVTE ERVVNRPPGK RQRVPSAYNQ  120
FIKEEIQRIK ANNPDISHRE AFSTAAKNWA HFPHIHFGLM LEANNQTKLH DASEKHIMSR  180
TALFNK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0902161e-65BT090216.1 Soybean clone JCVI-FLGm-3N14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447992.11e-138PREDICTED: axial regulator YABBY 5-like
SwissprotQ8GW461e-87YAB5_ARATH; Axial regulator YABBY 5
TrEMBLA0A0B0NJJ91e-139A0A0B0NJJ9_G
STRINGVIT_11s0016g05590.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55382649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.21e-81YABBY family protein